Protein Info for GFF1069 in Sphingobium sp. HT1-2

Annotation: 16S rRNA (uracil(1498)-N(3))-methyltransferase (EC 2.1.1.193)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR00046: RNA methyltransferase, RsmE family" amino acids 27 to 242 (216 residues), 112.5 bits, see alignment E=1e-36 PF20260: PUA_4" amino acids 30 to 71 (42 residues), 35.8 bits, see alignment 7.2e-13 PF04452: Methyltrans_RNA" amino acids 87 to 240 (154 residues), 146.2 bits, see alignment E=7.1e-47

Best Hits

KEGG orthology group: K09761, ribosomal RNA small subunit methyltransferase E [EC: 2.1.1.-] (inferred from 88% identity to sch:Sphch_2071)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>GFF1069 16S rRNA (uracil(1498)-N(3))-methyltransferase (EC 2.1.1.193) (Sphingobium sp. HT1-2)
MTATPAWPPQSAPRLHVETLLGEGVAVPVDGNGAHYLISVMRVKPDDIVLLFDGKSGEWA
ARARDIRKRDLVLECVAQTKPPEVVPDFWLCCAPIKKGRIDLIAEKACELGVARLQPVLT
RRAVVDKLNLDRLHAHLVEAAEQCGRTALPELTEMVKLDALLKGWSAERHLFFADETGGA
SLDETLRAHPGPAAFLVGPEGGFDPAEREAIRATPGAVPVSLGPRILRAETAAIAATAAW
MTVNGDWG