Protein Info for GFF1067 in Variovorax sp. SCN45

Annotation: Hydrolase, alpha/beta fold family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF00561: Abhydrolase_1" amino acids 22 to 257 (236 residues), 71.3 bits, see alignment E=1e-23 PF12697: Abhydrolase_6" amino acids 23 to 263 (241 residues), 68.6 bits, see alignment E=1.3e-22

Best Hits

KEGG orthology group: None (inferred from 74% identity to bja:blr3321)

Predicted SEED Role

"Alpha/beta hydrolase fold (EC 3.8.1.5)" (EC 3.8.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.5

Use Curated BLAST to search for 3.8.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>GFF1067 Hydrolase, alpha/beta fold family (Variovorax sp. SCN45)
MSFATTPDGVRLYYETAGSGTPIVFVHEFGGDHRSWEPQMRFFARRHQCVTFGARGYPPS
DVPADMERYSQATAADDILAVMDALGLRRAHIVGLSMGGFATLHFGLRHAARAASLVIAG
AGYGAEKEHEEYFRGVSLEVARQFEAQGSEKFARTYSLGASRVQFQNKDPRGWQEFATWL
GQHDSVGAANTMRGVQARRPSIYDLESELREMPVPSLVVVGDEDDHCLQPGIFLKKTVPA
CGLAVMPKTGHTLNLEEPAAFNALLAEFFAQVEAGQWKPRDPRALPSQIMKTD