Protein Info for PS417_05410 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 12 to 25 (14 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 142 to 159 (18 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details PF10129: OpgC_C" amino acids 5 to 363 (359 residues), 382.7 bits, see alignment E=8e-119

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfs:PFLU1105)

Predicted SEED Role

"OpgC protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2N6 at UniProt or InterPro

Protein Sequence (382 amino acids)

>PS417_05410 membrane protein (Pseudomonas simiae WCS417)
MLNGRDPRIDFFRGLALIFIFWDHVPHNPLGQITLRNIGFSDAAEVFVFLAGYAAVLAYG
KILQRDGYWIASLKILRRAWVLYVVHIFLLAMLMGIVFFANSHVETRDLVEEMGLTHFVT
HPQQALTDELLLRFKPNLMDPLPLYIVLLSGLPLVLPLLLRKTWAVVGVSLTVYLLAPWM
GWNLRAIADGVWYFNPVTWQLLFVLGGAAAIHARQPRPVETRGLLRQPLFVAAAAYSVMA
GIITISWRWPEAHDAWMPSPLSDLLYPISKTDLSPVRLLHFLALAYVTAKLLPGMGWTRH
WLAQQSCRMGRYSLEVFCLGVLLAPLADMLNALAGDALAMQLFSATVGVVLMGLLAAWLE
FNKRLDKSLQDRRVLAMPSSTG