Protein Info for GFF1061 in Variovorax sp. SCN45

Annotation: Hydroxymethylpyrimidine ABC transporter, transmembrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 75 to 248 (174 residues), 88.7 bits, see alignment E=2e-29

Best Hits

Swiss-Prot: 32% identical to Y355_HAEIN: Probable ABC transporter permease protein HI_0355 (HI_0355) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 46% identity to azc:AZC_2449)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>GFF1061 Hydroxymethylpyrimidine ABC transporter, transmembrane component (Variovorax sp. SCN45)
MVAQRKLMASPVVPVVLSIVVLLAVWEGAILLFKIPPFVLPSLGSIVQHAFTDTGRLMAA
LLATLGEALGGYALGSILGLLLAVLLLLAPPLERVVMPLAVAVNAVPTVAYAPLFLIWFG
LGAASKIALVALAVGFTMLVNALHGLKQADAAAVNLMRSFGAGPLKIVWRLRLPVAMPSV
VTALRIGVPRSMIVAIVGEMLGAYAGLGRMIYESTQQVDLLSVWSAVLIASVASMVFYGL
LVWIDQKLVWWR