Protein Info for GFF1061 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Aerotaxis sensor receptor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 147 to 167 (21 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 1 to 93 (93 residues), 45 bits, see alignment E=5.5e-16 PF00989: PAS" amino acids 3 to 84 (82 residues), 32.2 bits, see alignment E=2.7e-11 PF08448: PAS_4" amino acids 4 to 92 (89 residues), 23.9 bits, see alignment E=1.3e-08 PF13426: PAS_9" amino acids 4 to 90 (87 residues), 41.2 bits, see alignment E=5.2e-14 PF08447: PAS_3" amino acids 11 to 92 (82 residues), 58.8 bits, see alignment E=1.6e-19 PF00672: HAMP" amino acids 192 to 236 (45 residues), 24.2 bits, see alignment 1e-08 PF00015: MCPsignal" amino acids 306 to 462 (157 residues), 183.6 bits, see alignment E=9e-58

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 66% identity to bur:Bcep18194_B0268)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>GFF1061 Aerotaxis sensor receptor protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSTTDTQSHITYANDAFVAVSGYSREEIESQPHNLVRHPDMPVEAFKDMWATLQGGEPWT
GLVKNRRENGDHYWVRANATPVKRDGVITGYMSVRTKPSQEEVASANALYAKFRNGQAGD
LGFRKGLISRTGMMRWMSIMQAISAEARSNIGLSIATLLVGTGAWHAGLAGTALAQFLAL
LTVSMLLASLWMRYQIYKPLAQLREHALRLATGDFHSATHMNRIDEIGMTMRAVGQLGLM
FRWVIDDVREQVLNAKIAASEIAQGNNDLSSRTEQAAASVEQTAASMEEMSAIVKNNAET
SQQAAKLSSSASEAADKGGRAVADVIHTMNDIAHSSNKIGDIIGVIDSIAFQTNILALNA
AVEAARAGAQGRGFAVVAAEVRSLAHRSAEAAKEIKSLIGASVEKVNAGSLMVDGAGRTM
KEIVVEVNRVSHMIAEISTATREQSDGITQVATAVGHLDQVTQQNAALVEQSTAASESLR
TQMELLVKAVNVFK