Protein Info for GFF1059 in Variovorax sp. SCN45

Annotation: Hydroxymethylpyrimidine ABC transporter, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF00005: ABC_tran" amino acids 41 to 182 (142 residues), 99.3 bits, see alignment E=1.5e-32

Best Hits

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 74% identity to pao:Pat9b_1818)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, ATPase component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>GFF1059 Hydroxymethylpyrimidine ABC transporter, ATPase component (Variovorax sp. SCN45)
MKFMPHEVMPPAAADTAPPMLELVNVWKRFGEAQSRTVAVSGVNLRIAKSEFVTLVGPSG
CGKSTLFNMIAGLLPPDDDGSLLFGGAPQRDGQLLGKVSFMPQRDLLFPWRTVLDNAILA
LEVEGTPRKEARERARAMLPEFGLAGFANHYPHQLSGGMRQRVALMRTFLFERDLMLLDE
PFGALDALTRTRMQHWLLELWARHRRTVLFITHDIDEAILLGDKVLVMTARPGTVKSETV
IDLPRPRDPSVVLTPEFIGLKQRLLAEIEEESQKTFAQEGTAP