Protein Info for GFF1059 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 TIGR03719: ATP-binding cassette protein, ChvD family" amino acids 2 to 553 (552 residues), 980.8 bits, see alignment E=2e-299 PF00005: ABC_tran" amino acids 22 to 191 (170 residues), 104.8 bits, see alignment E=1.1e-33 amino acids 340 to 473 (134 residues), 90.5 bits, see alignment E=3.1e-29 PF12848: ABC_tran_Xtn" amino acids 230 to 306 (77 residues), 45.7 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 97% identical to ETTA_ECOLI: Energy-dependent translational throttle protein EttA (ettA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to eco:b4391)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (555 amino acids)

>GFF1059 ABC transporter, ATP-binding protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VAQFVYTMHRVGKVVPPKRHILKNISLSFFPGAKIGVLGLNGAGKSTLLRIMAGLDKDIE
GEARPQPGIKIGYLPQEPQLNPEHTVRESIEEAVSEVVNALKRLDEVYALYADPDADFDK
LAAEQGRLEEIIQAHDGHNLNVQLERAADALRLPDWDAKVEKLSGGERRRVALCRLLLEK
PDMLLLDEPTNHLDAESVAWLERFLHDFEGTVVAITHDRYFLDNVAGWILELDRGEGIPW
EGNYSSWLEQKDQRLAQEASAEAARRKSIEKELEWVRQGAKGRQSKGKARLARFEELNSV
EYQKRNETNELFIPPGPRLGDKVIEVSNLRKSYGDRVLIDDLSFSVPKGAIVGIIGPNGA
GKSTLFRMMSGQEQPDSGTITLGETVKLASVDQFRDAMDNSKTVWEEVSGGLDIMKIGNT
EMPSRAYVGRFNFKGVDQGKRVGELSGGERGRLHLAKLLQVGGNVLLLDEPTNDLDIETL
RALENALLEFPGCAMVISHDRWFLDRIATHILDYQDEGKVEFFEGNFTEYEEYKKRTLGA
EALEPKRIKYKRIAK