Protein Info for GFF1053 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR00229: PAS domain S-box protein" amino acids 10 to 132 (123 residues), 75.2 bits, see alignment E=2.5e-25 PF00989: PAS" amino acids 16 to 122 (107 residues), 37.8 bits, see alignment E=6.1e-13 PF08448: PAS_4" amino acids 16 to 127 (112 residues), 25.2 bits, see alignment E=5.6e-09 PF13426: PAS_9" amino acids 21 to 125 (105 residues), 43.9 bits, see alignment E=8.5e-15 PF07568: HisKA_2" amino acids 146 to 221 (76 residues), 92.6 bits, see alignment E=4.5e-30 PF07536: HWE_HK" amino acids 146 to 212 (67 residues), 28.7 bits, see alignment E=6.3e-10 PF13581: HATPase_c_2" amino acids 239 to 318 (80 residues), 29.1 bits, see alignment E=3.2e-10 PF02518: HATPase_c" amino acids 248 to 337 (90 residues), 45.5 bits, see alignment E=3.3e-15

Best Hits

KEGG orthology group: None (inferred from 40% identity to gau:GAU_3206)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>GFF1053 Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTAQHLALDEYLGQAFNRIPIAMLVVDKNGEIIRTNELAETSFGYASDELIGQKVEVLLP
SRYRHMHPGHRGDFLAKPSARPMGAGRDLSGMRKDGREFPVEIAINPVETGEGPMILTVI
LDLSERKQNEKRIQDALQQKDLLLKEVHHRVKNNLQVIHSLLDLQALKISNADMVDLLRD
SQNRIRSMSLIHQTLYQSQDFAQVDFQLLLGELLPRLTESYGLSSRQVRIGIQALDVKLP
INEAIPCGLIVNELVSNALKHGFPEDRRGTVMVEISQDTEQVVKLSISDDGQGIPLDMDL
SKSESLGLQLVNLLTRQLHGQLDVQRRDPTRFTLRFRXGDKS