Protein Info for GFF1048 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: NnrS protein involved in response to NO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 197 to 214 (18 residues), see Phobius details amino acids 220 to 237 (18 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details PF05940: NnrS" amino acids 1 to 368 (368 residues), 303.2 bits, see alignment E=1.7e-94

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 69% identity to net:Neut_0621)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>GFF1048 NnrS protein involved in response to NO (Hydrogenophaga sp. GW460-11-11-14-LB1)
LGFRPLYLAGCFWAAVSVVLWVFAPDLLRGQLVGVVWHAHEMLWGFIATIAVGFLLTAGS
NWTGINPLKGRALGALSLLWVLTRVGYLVPAESSFWLAVGCELLFFAWAAAALGRAIYGA
RNQRNYGVPLLVLALGVADALFLLAAWQGDHALLMQRFNAGLLCMAMVALLVARRVIPFF
AMRAVPALTIPMHTRSGHWQLGASGLAIGLELLGWRPAMAAFLAAAGVIALVQVLAWKPW
AVRRVPLLWILYLGYAALGVGLLVTAAHAVGWVLRAAWSVHVIGVVGFSVLIIGMVTRTA
LGHLGRPLRSDRLIVWCYALVMAAAALRLLALLPTSLALGALHASAGAWVLAFGLYLWRF
FPMMIRPRIDQATTPVLKPGKLPKRQRTPQ