Protein Info for GFF1046 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cytochrome c oxidase subunit CcoN (EC 1.9.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 174 to 197 (24 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 338 to 360 (23 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details amino acids 418 to 438 (21 residues), see Phobius details amino acids 450 to 475 (26 residues), see Phobius details amino acids 504 to 525 (22 residues), see Phobius details PF00115: COX1" amino acids 95 to 508 (414 residues), 276.5 bits, see alignment E=2.1e-86

Best Hits

KEGG orthology group: K00404, cb-type cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 94% identity to pol:Bpro_1267)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoN (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>GFF1046 Cytochrome c oxidase subunit CcoN (EC 1.9.3.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDSAILSLLGAFLLSIIGLFAFIWSLRKGLLVENPRAASVIFARGEIGRVDDPALDDTTQ
GAMQAAAPPAAEAATVAQGEISDHIEADRSSAFPVFMFIAFACLWLLVGSVAGLIASYKL
HEPDWLVQQAWLTFGRIRTVHLNAVIYGWSSNAALAVILWLLPRMLRTPLHGGIWAMMGG
SLINTGIAAGIGAIAVGWSDGMEFLEIPWQIDIFIFAGFALTILPALYTLVNRRVEHLYV
SVWYFTAALLWIAVLFLVANLPGVHTGVQQATTNWWYGHNALGLWFTPVAVGAIYYFLPK
IIGRPVVSYNLSLLGFWTLAFFYGQVGGHHLIGGPIPGWLTTLSIVQSVMMIIPVLAFTI
NMKGTLKGQMHLARYSPTLRFMMFGGLMYFASSVQGSLEALRNINAVTHFTHFTVAHAHL
GMYAFVTMVFFGAIYFMMPRVLEWEWPYPWLITLHFWLAALGIGIYVVGLTIGGWLQGVA
MLDAARPFGESVAVTLPWLKSRTVGGLVMTLGHLVFVGHFLAMALRFGPDRAGAALFSQP
GGIAHGK