Protein Info for PS417_05265 in Pseudomonas simiae WCS417

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00106: adh_short" amino acids 4 to 190 (187 residues), 160.2 bits, see alignment E=6.8e-51 PF08659: KR" amino acids 6 to 167 (162 residues), 58.5 bits, see alignment E=1.3e-19 PF13561: adh_short_C2" amino acids 10 to 248 (239 residues), 221.2 bits, see alignment E=2.3e-69

Best Hits

Swiss-Prot: 35% identical to FABG_BACSU: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Bacillus subtilis (strain 168)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 97% identity to pba:PSEBR_a2176)

MetaCyc: 35% identical to 3-oxoacyl-[acyl-carrier-protein] reductase (Bacillus subtilis subtilis 168)
3-oxoacyl-[acyl-carrier-protein] reductase. [EC: 1.1.1.100]

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGJ7 at UniProt or InterPro

Protein Sequence (253 amino acids)

>PS417_05265 short-chain dehydrogenase (Pseudomonas simiae WCS417)
MSRKVALITGAASGIGQALAVAYARNGVAVVGGYYPADPHDPQTTVSLVEEAGGECLMLP
LDVGDTASVDALAAQTIQHFGRLDYAVANAGLLRRAPLLEMTDALWDEMLNVDLTGVMRT
FRAATRHMQEGGALVAISSIAGGVYGWQEHSHYAAAKAGVPGLCRSLAVELAAKGIRCNA
VIPGLIETPQSLDAKNSLGPEGLAKAARAIPLGRVGRADEVASLVQFLTSDASSYLTGQS
IVIDGGLTVRWPD