Protein Info for GFF1039 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details PF02077: SURF4" amino acids 10 to 135 (126 residues), 41.1 bits, see alignment E=2.5e-14 PF07291: MauE" amino acids 13 to 93 (81 residues), 35.8 bits, see alignment E=1.4e-12 PF07681: DoxX" amino acids 14 to 95 (82 residues), 72.2 bits, see alignment E=7e-24

Best Hits

KEGG orthology group: None (inferred from 60% identity to mpt:Mpe_A0014)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (141 amino acids)

>GFF1039 putative membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MEKIMLDNFKVPLVLVGRVFLALMFILSGVDKLMQIEGNTAYMASGGLPAWSPLTVLVGL
IELLGGLAVATGFQARWAALVLALFTLGASLIYHRYWSLPADQQMVQQLLFMKNIAVAGG
MLVVASLGPGLASLGNRGGAG