Protein Info for PS417_05255 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF01522: Polysacc_deac_1" amino acids 43 to 145 (103 residues), 67.5 bits, see alignment E=1.1e-22 PF10096: DUF2334" amino acids 67 to 145 (79 residues), 29.7 bits, see alignment E=5.2e-11

Best Hits

Swiss-Prot: 77% identical to PGDAE_HELPG: Peptidoglycan deacetylase (pgdA) from Helicobacter pylori (strain G27)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU1073)

Predicted SEED Role

"Putative polysaccharide deacetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYC7 at UniProt or InterPro

Protein Sequence (292 amino acids)

>PS417_05255 hypothetical protein (Pseudomonas simiae WCS417)
MAKDILCAFGVDVDAVAGWLGSYGGEDSPDDISRGLFAGEVGAPRLLKLFERYGLRTTWF
IPGHSMETFPEQMKAVADAGHEIGVHGYSHENPIAMTAEQEEIVLDKSIELITQVTGKRP
TGYVAPWWEFSKVTNELLLKKGIKYDHSLMHNDFHPYYVRKGDSWTKIDYSQHPDTWMKP
LVRGEETDLVEIPANWYLDDLPPMMFIKKAPNSHGFVNPRHLEEMWRDQFDWVYREHEHA
VFTMTIHPDVSGRPQVLLMLERLIEHIQSHAGVRFVTFDEIADDFIRRQPRT