Protein Info for GFF1037 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Osmotically inducible protein OsmY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF04972: BON" amino acids 59 to 126 (68 residues), 74.8 bits, see alignment E=2.7e-25 amino acids 139 to 205 (67 residues), 70.2 bits, see alignment E=7.6e-24

Best Hits

Swiss-Prot: 89% identical to OSMY_ECOL6: Osmotically-inducible protein Y (osmY) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K04065, hyperosmotically inducible periplasmic protein (inferred from 100% identity to sei:SPC_4697)

Predicted SEED Role

"Osmotically inducible protein OsmY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>GFF1037 Osmotically inducible protein OsmY (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTMTRLKISKTLLAVMLTSAVATGSAFAENATTDKAQSGTETAGQKVDSSMNKVGNFMDD
SAITAKVKAALVDHDNIKSTDISVETNQKVVTLSGFVESQAQAEAAVKVAKGVEGVTSVS
DKLHVRDNKEGSVKGYAGDTATTSEVKAKLLADDLVPSRKVKVETTDGVVQLSGTVETQE
QSDRAESIAKAVDGVKSVKNDLKVQ