Protein Info for GFF1032 in Variovorax sp. SCN45

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 6 to 260 (255 residues), 332 bits, see alignment E=1e-103 PF00106: adh_short" amino acids 6 to 198 (193 residues), 188 bits, see alignment E=2e-59 PF08659: KR" amino acids 10 to 174 (165 residues), 46.3 bits, see alignment E=7.3e-16 PF13561: adh_short_C2" amino acids 12 to 257 (246 residues), 171 bits, see alignment E=5.1e-54

Best Hits

Swiss-Prot: 40% identical to YXJF_BACSU: Uncharacterized oxidoreductase YxjF (yxjF) from Bacillus subtilis (strain 168)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 100% identity to vpe:Varpa_3666)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>GFF1032 Oxidoreductase, short-chain dehydrogenase/reductase family (Variovorax sp. SCN45)
MQLKDKVAYITGSASGIGKEIAILFAQEGAKIIIADLNKEAADATAAELKATGAQAIGVA
VDVTNEDQVNASVEEGAKAFGGIDILISNAGIQIVHPVEEFSFADWKKMLAIHLDGAFLT
TKACLKHMYAQGRGGSVIYMGSVHSKEASLLKAPYVTAKHGLIGLAKTVAKEGAKHGVRA
NVICPGFVRTPLVEKQIPEQAKTLGISEEEVIKNVMLKETVDGEFTTTEDVARVALLFAG
FPTNALTGQSLVVSHGWFMQ