Protein Info for GFF1029 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 54 to 80 (27 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 141 to 302 (162 residues), 158.6 bits, see alignment E=5.9e-51 PF00990: GGDEF" amino acids 144 to 298 (155 residues), 159.1 bits, see alignment E=8.4e-51 PF17853: GGDEF_2" amino acids 156 to 288 (133 residues), 25.8 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: None (inferred from 99% identity to stt:t4594)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>GFF1029 Putative membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIGIVVLSVLLLIWHGKYGQKRINLPFISLLFGGIWAAHIALKYPALGHYDFSFLLISLL
SVLFIGSIAFAANIVAFTLYSLPPVAVCLWLNGNEQGLRILYLLTLPMVGIAIQHVIQKR
YDNFAQQLMFKLLAERETLNGLSMLDPLTGLYNRRGLQNRLDTLQAPGSHEHYVLLLDID
HFKAYNDHYGHMMGDQALIRVSAAIRDAVRSRDVVCRFGGEEFLVLLTTAEPQQARATAE
RIRQEVYDLKIPHMFNESVATNVTVSIGIAPLTDRNIGDAIEKADKALYEAKHLGRNHIL
VSDDMRAL