Protein Info for GFF1027 in Variovorax sp. SCN45

Annotation: Ribonuclease BN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 31 to 54 (24 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 141 to 166 (26 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 249 to 276 (28 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 14 to 275 (262 residues), 89 bits, see alignment E=2.4e-29 PF03631: Virul_fac_BrkB" amino acids 24 to 278 (255 residues), 191.5 bits, see alignment E=1.1e-60

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 92% identity to vpe:Varpa_3671)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>GFF1027 Ribonuclease BN (Variovorax sp. SCN45)
MLMQLRALFDLCKKAFNSWSNDYAPSMGAALAYYTVFSIAPLLLIVIAVAGLVFGQEAAR
GEIFAQLSGLMGEQGAAAVQGMLKAVNKPAEGIVATVIGIGLLVVGATTVFGELQDALDR
IWRAPARTKNKGLFNMLRVRLLSFSMIMGIGFLLMVSLVASAALAALGKWWSPMFGAWET
TAQVVNFVFSFGMVMVIFAMIYKIMPRAKVQWRDVWVGAAVTALLFTVGKHLIGLYIGKS
SVASGYGAAGSLVVVLVWVYYSAQIFLLGAEFTWVYARTYGSMKGMEGAAELNPSPTRNV
PLPHNDN