Protein Info for GFF1026 in Variovorax sp. SCN45

Annotation: Probable chromate transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 81 to 107 (27 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 169 to 186 (18 residues), see Phobius details PF02417: Chromate_transp" amino acids 14 to 178 (165 residues), 126.4 bits, see alignment E=5.9e-41

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 89% identity to vpe:Varpa_3672)

Predicted SEED Role

"Probable chromate transporter protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>GFF1026 Probable chromate transporter protein (Variovorax sp. SCN45)
MHPSPSAQPQSPRDLFFSFTWLALQGFGGVLAIVQREVVEKKKWLTPEQFLEDWAVAQVM
PGPNVINLALMIGDRYFGLRGALAAVAGMLSIPLVVILALAVLYAHYAGNPQVAAALRGM
GAVSGGLIAATGIKLVPQLRKHPLGFATCLVFMGLVFCAIALFKVPLGWVLLVLGGVACV
WTWKKIPA