Protein Info for GFF1023 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG023911: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 172 to 191 (20 residues), see Phobius details amino acids 197 to 214 (18 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 285 to 309 (25 residues), see Phobius details PF06738: ThrE" amino acids 69 to 307 (239 residues), 220.7 bits, see alignment E=1e-69

Best Hits

Swiss-Prot: 90% identical to YJJP_ECOLI: Inner membrane protein YjjP (yjjP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to seh:SeHA_C4954)

Predicted SEED Role

"FIG023911: putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF1023 FIG023911: putative membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VTKRTSQEAYALRLAVDVFINKKLILTNAIMPVLRVKKEASVIVAAHRMSFRTGRVMQEE
QSIQRAVTRLCIQCGLFLLQHGAESALVDELSTRLGLALGMDSVESAISSNAIVLTTIKD
GQCLTSTRKNQDRGINMHVVTEVQHIVILAEHRLLDYKGVEKRFSQLRPLRYPRWLVAFM
VGLSCSCFCKLNNGGWDGAVITFFASMIAMYIRQMLAQRHLHPQINFCITAFVATTISGL
MLTLPAFSQTPTIAMAASVLLLVPGFPLINSVADMFKGHINTGLARWAIASLLTLATCVG
VVMSMTVWGLRGWV