Protein Info for PS417_05175 in Pseudomonas simiae WCS417

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 271 to 296 (26 residues), see Phobius details amino acids 305 to 322 (18 residues), see Phobius details amino acids 333 to 355 (23 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 4 to 357 (354 residues), 423.7 bits, see alignment E=2e-131 PF03739: LptF_LptG" amino acids 6 to 357 (352 residues), 254.1 bits, see alignment E=1.1e-79

Best Hits

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 97% identity to pfs:PFLU1057)

Predicted SEED Role

"FIG000906: Predicted Permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7H5 at UniProt or InterPro

Protein Sequence (359 amino acids)

>PS417_05175 permease (Pseudomonas simiae WCS417)
MAKLDRYIGSSVLIAILAVLGIILGLASLFAFIDEVGNVTDTYTVWDVLSYVGLTAPRRL
YDMMPMAALIGCLIGLGSLASNSELTIMRAAGVSIGRIVWAVMKPMLLLMACSVLIGEYV
APPAETTAQANRALAQGSGDAQSAKHGLWHRQGDEFIHINAVQPGGLLIGVTRYTFDKER
HLLESSFAKRAQYSGEKWQLSDVTTTYFRNVGQGTKASTEVINVPSQEWDIALKPELLNT
VVMIPESLPISGLWGYIHYLKDQGLNNGRYWLAFWVKVLQPVVTAALVLMAISFIFGPLR
SVTLGQRVFTGVLVGFTFRIAQDLLGPSSLVFGFSPLFAVLVPTAICALAGFWLLRRAG