Protein Info for GFF1021 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Primosomal protein I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF17948: DnaT" amino acids 89 to 155 (67 residues), 70.1 bits, see alignment E=5.2e-24

Best Hits

Swiss-Prot: 100% identical to DNAT_SALPB: Primosomal protein 1 (dnaT) from Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

KEGG orthology group: K02317, DNA replication protein DnaT (inferred from 99% identity to sed:SeD_A4958)

MetaCyc: 82% identical to primosomal protein DnaT (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Primosomal protein I" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>GFF1021 Primosomal protein I (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSSRILTSDVIGIDVLLHDHHAVLAKSTGGAVAVFANNAPAFYAVTPARMAELLALEEKL
SRPGSDVALDAQFYEEPEAAPVAIPCGKFAMYPAWQPDADFQRQAALWGVALREPVTAEE
LAAFIAYWQAEGKVFHHIQWQQKLARSVQISRSSNGGMPQRDINSVSEPDNHIPPGFRG