Protein Info for GFF102 in Variovorax sp. SCN45

Annotation: General secretion pathway protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 166 to 188 (23 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 260 to 274 (15 residues), see Phobius details amino acids 371 to 394 (24 residues), see Phobius details PF28597: T2SSF_N" amino acids 1 to 43 (43 residues), 57.3 bits, see alignment 1.1e-19 TIGR02120: type II secretion system protein F" amino acids 4 to 400 (397 residues), 490.6 bits, see alignment E=2.1e-151 PF00482: T2SSF" amino acids 68 to 190 (123 residues), 108.2 bits, see alignment E=2.8e-35 amino acids 270 to 392 (123 residues), 92.2 bits, see alignment E=2.6e-30

Best Hits

Swiss-Prot: 44% identical to GSPF_PSEAE: Type II secretion system protein F (xcpS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 65% identity to pae:PA0687)

MetaCyc: 34% identical to type II secretion system protein GspF (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>GFF102 General secretion pathway protein F (Variovorax sp. SCN45)
MARFEYEAASASGELQRGTTEGESARSVRAQLRDRGLTPLDIREKAAGGGALSWLSPRLG
AADLCWATRELASLLGARLTLEAALVATIEQAERKHVAESLSAVCDSVRAGMRLADALGE
RPRDFPQIYRALVSAGEDSGDLARVMERLADYLENRDNLRGKVLTAFIYPAIVGFVSLCI
VVFLLGYVVPQVIGAFAQARQELPTITRVMLAASAFVREWGWLTAGVVVAAWVAARALLR
DAAHKLKWHGLILRMPMVGRFALGVDTARFASTLSILMDAGVPLLRALEAARQTLVNEWL
KRCVLEATGRVKEGTPLAAALKAQKIFPSNLVHLVASGEKTGALAAMFERAALNLSRDLE
RRAMRLTTLLEPLMILAMGGVVMAIVLAVLMPIMEINQMVR