Protein Info for GFF1014 in Variovorax sp. SCN45

Annotation: Arylesterase precursor (EC 3.1.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00657: Lipase_GDSL" amino acids 30 to 199 (170 residues), 60.5 bits, see alignment E=2.7e-20 PF13472: Lipase_GDSL_2" amino acids 32 to 194 (163 residues), 97.2 bits, see alignment E=1.7e-31

Best Hits

Swiss-Prot: 54% identical to EST_PSEAE: Esterase TesA (tesA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10804, acyl-CoA thioesterase I [EC: 3.1.1.5 3.1.2.-] (inferred from 91% identity to vpe:Varpa_3684)

Predicted SEED Role

"Arylesterase precursor (EC 3.1.1.2)" (EC 3.1.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.5, 3.1.2.-

Use Curated BLAST to search for 3.1.1.2 or 3.1.1.5 or 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>GFF1014 Arylesterase precursor (EC 3.1.1.2) (Variovorax sp. SCN45)
LTTAALGSAGTWTTAAHAQAPASAAGKPVILVLGDSLSAEYGLKRGEGWVPLLEKRLAQQ
KIAATVVNASISGDTSSGGRARFPSLLAQHKPSLVVLELGANDALRGLPLADTESNLLQI
TKAAQAAGAKVLIVGIQVPPNYGGDYTRRFEAVFSKVAGATRSALVPFLLKGVADAPDAL
SLFQADRIHPTAAAQPQLLDNVWSELRKLLPK