Protein Info for GFF1013 in Pseudomonas sp. DMC3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF13185: GAF_2" amino acids 25 to 153 (129 residues), 42.6 bits, see alignment E=1.1e-14 PF01590: GAF" amino acids 26 to 157 (132 residues), 65.8 bits, see alignment E=9e-22 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 161 to 316 (156 residues), 133.8 bits, see alignment E=2.3e-43 PF00990: GGDEF" amino acids 163 to 316 (154 residues), 134.6 bits, see alignment E=4.1e-43

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfo:Pfl01_2176)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>GFF1013 hypothetical protein (Pseudomonas sp. DMC3)
MLVPGKPANEAARIDALHGLNLNSEPEERFDRLTRLAKRLFNVPIALVTLVDKDRQWFKS
CVGLDVSETSRDVSFCGHAILQNELMLVPDALEDLRFHDNPLVTGAPNIRFYAGYPLTVP
DGNKMGTLCLIDTKPRNLDDEERALLRDLAEMAEQELLAVQMASMDELTLLSNRRGFKQL
AQHALDACARLNRPATLLFFDLNDFKQINDLYGHAEGDSALKTFADVLRIAFRESDVVGR
LGGDEFVALLTGSSHVETTRIMARLKEILEERNATLHRGYAIRFSVGQIEYDPTRHETVD
RLLADADGAMYAHKQALKGC