Protein Info for PS417_00510 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 45 to 97 (53 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 163 to 226 (64 residues), see Phobius details amino acids 238 to 262 (25 residues), see Phobius details amino acids 270 to 295 (26 residues), see Phobius details TIGR00704: Na/Pi-cotransporter II-related protein" amino acids 1 to 308 (308 residues), 331.3 bits, see alignment E=7.3e-103 PF02690: Na_Pi_cotrans" amino acids 13 to 147 (135 residues), 117.7 bits, see alignment E=4.2e-38 amino acids 160 to 243 (84 residues), 32.8 bits, see alignment E=6.7e-12 TIGR01013: sodium-dependent inorganic phosphate (Pi) transporter" amino acids 67 to 521 (455 residues), 344.3 bits, see alignment E=1.2e-106 PF01895: PhoU" amino acids 340 to 425 (86 residues), 30.6 bits, see alignment E=3.7e-11

Best Hits

Swiss-Prot: 62% identical to YJBB_ECO57: Uncharacterized protein YjbB (yjbB) from Escherichia coli O157:H7

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 99% identity to pfs:PFLU0101)

MetaCyc: 62% identical to putative inorganic phosphate export protein YjbB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-470

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U886 at UniProt or InterPro

Protein Sequence (552 amino acids)

>PS417_00510 membrane protein (Pseudomonas simiae WCS417)
MLTLLNLLSAVTLLIWGTHIVRTGILRVYGSNLRQVIGQNMSKRWLAFIAGILVTAMVQS
SNATAMLVTSFVGQGLMGLMPALATMLGADVGTALMARVLTFDLSWLSPLLIFLGVIFFL
SRKQTRAGQLGRVGIGLGLIILALQLIVEAAGPITHAQGVKVLFASLTGDILLDALVGAL
FAMISYSSLAAVLLTATLAGAGVIGLHVAIGLVIGANIGSGVLAFLSTSMQNAAGRQVAL
GSLLYKLIGLLLIIPVLDPLVLWMDGLDYSAQGMVITFHLLYNVTRCLILLPTIGPMARL
CAWLLPEREETNGKAKPRHLDLAALATPSLALANAARETLRLGDLIDNMLTAMQEVLRGK
QTAITQEMRSLSDDVESLYSAIKLYLAQMPREDLSEQDSRRWAEIIELSINLKLAGDLIE
RMLRKVQQQKTSQRRQFSEVGLEELTGLHGQLIANLRLGLSVFLSADPESARQLLREKRR
FRAQERRLAHAHVSRLQRKIVQSLETSSLHLELIADMKRLNSLFCSSAYVVLETSDTGAL
SAEDIADITHSP