Protein Info for GFF1008 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Carbon starvation protein A paralog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 683 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 455 to 474 (20 residues), see Phobius details amino acids 500 to 519 (20 residues), see Phobius details amino acids 532 to 556 (25 residues), see Phobius details amino acids 563 to 583 (21 residues), see Phobius details amino acids 632 to 653 (22 residues), see Phobius details PF02554: CstA" amino acids 1 to 373 (373 residues), 559.6 bits, see alignment E=3.2e-172 PF13722: CstA_5TM" amino acids 453 to 581 (129 residues), 135.7 bits, see alignment E=1.1e-43

Best Hits

Swiss-Prot: 96% identical to BTST_ECOLI: Pyruvate/proton symporter BtsT (btsT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to cro:ROD_48371)

MetaCyc: 96% identical to pyruvate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-335

Predicted SEED Role

"Carbon starvation protein A paralog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (683 amino acids)

>GFF1008 Carbon starvation protein A paralog (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VSALWIVVASVSVYLVAYRYYSLYIAQKVMKLDPTRATPAVINNDGLNYVPTNRYVLFGH
HFAAIAGAGPLVGPVLAAQMGYLPGTLWLLAGVVLAGAVQDFMVLFISSRRNGASLGEMI
KEEMGTVPGTIALFGCFLIMIIILAVLALIVVKALAESPWGVFTVCSTVPIALFMGIYMR
FLRPGRVGEVSVIGIVLLVASIYFGGVIAHDPYWGPALTFKDTTITFALIGYAFVSALLP
VWLILAPRDYLATFLKIGVIVGLALGIVILNPELKMPALTQYVDGTGPLWKGALFPFLFI
TIACGAVSGFHALISSGTTPKLLACETDARFIGYGAMLMESFVAVMALVAASIIEPGLYF
AMNTPPAGLGITMPNLHEMGGENAPLIMAQLKDVTAHAAATVSSWGFVISPEQILQTAKD
IGEPSVLNRAGGAPTLAVGIAHVFHKVLPMADMGFWYHFGILFEALFILTALDAGTRSGR
FMLQDLLGNFVPFLKKTDSLVAGIIGTAGCVGLWGYLLYQGVVDPLGGVKSLWPLFGISN
QMLAAVALVLSTVVLIKMQRTKYIWVTVIPAVWLLICTTWALGLKLFSANPQMEGFFYMA
NLYKEKIANGANLTEQQIANMNHIVVNNYTNAGLSILFLVVVYSIIFYGFTTWMKVRNSD
KRTDKETPYVPVPEGGVKISSHH