Protein Info for GFF1007 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00657: Lipase_GDSL" amino acids 194 to 390 (197 residues), 76.5 bits, see alignment E=3.4e-25 PF13472: Lipase_GDSL_2" amino acids 197 to 384 (188 residues), 100.1 bits, see alignment E=2.3e-32

Best Hits

KEGG orthology group: None (inferred from 42% identity to amd:AMED_8150)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>GFF1007 hypothetical protein (Sphingobium sp. HT1-2)
MGKRMLLGAALLAMVAATPAQAQYWSRSWMAAPLVNRAPPEKHPDLNDRTVRQVVRLSSG
GQRIRIRLSNEMSVNPLLVGSVHVALAGENGAIVPGSDHVVTFNQAQGATIPARAPLLSD
PIDLAVKPLTRISISIHLPQGAADATVHSYSAATTWTAPGDQTGAETLTSPTVIGPRVVI
SAVEVDNAKRGTAIVTLGDSITDGVRATPDSNRRWPDLLAERLQKAGRKSVGVANAGISA
NRLLSEADGYNALARFDSDVLAVPGVTHVVILEGVNDLGGAARDKRPMLTPQTVIGAYRQ
MIARAHDRNIKVILATILPYKGAGYWSAEGDAVRVAVNDWIRTTKEADGFVDLAKAVADP
ADPSRMAKPYDVGDALHPNDEGFRVMADAFDLRLFK