Protein Info for PS417_05100 in Pseudomonas simiae WCS417

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 9 to 154 (146 residues), 68.4 bits, see alignment E=2.8e-23 PF04542: Sigma70_r2" amino acids 10 to 75 (66 residues), 53 bits, see alignment E=5.8e-18 PF07638: Sigma70_ECF" amino acids 31 to 154 (124 residues), 27.5 bits, see alignment E=7e-10 PF08281: Sigma70_r4_2" amino acids 106 to 158 (53 residues), 55.2 bits, see alignment E=1.1e-18 PF04545: Sigma70_r4" amino acids 111 to 158 (48 residues), 30.9 bits, see alignment E=4e-11

Best Hits

Swiss-Prot: 52% identical to FECI_ECOLI: Probable RNA polymerase sigma factor FecI (fecI) from Escherichia coli (strain K12)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 94% identity to pfs:PFLU1042)

MetaCyc: 52% identical to RNA polymerase sigma factor FecI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"FIG006045: Sigma factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2L0 at UniProt or InterPro

Protein Sequence (162 amino acids)

>PS417_05100 RNA polymerase sigma factor (Pseudomonas simiae WCS417)
MSPPNTVEVLYNDHHHWLTGWLRRKLGCPESAADLAQDTFMRVLTAREAPTLIEPRAFLT
TVAKRVLFNFYRRQDLERAYLDALAQMPEHVAPSEEERAIILQTLVELDQLLDGLPVQVK
RAFLLAQCDGLTYAQIGAELGISIATVKRHLSKAAMRCYFAL