Protein Info for GFF1005 in Variovorax sp. SCN45

Annotation: ATP phosphoribosyltransferase regulatory subunit (EC 2.4.2.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF13393: tRNA-synt_His" amino acids 9 to 317 (309 residues), 388 bits, see alignment E=3.3e-120 TIGR00443: ATP phosphoribosyltransferase, regulatory subunit" amino acids 12 to 321 (310 residues), 272.7 bits, see alignment E=1.9e-85 PF27460: HisZ_C" amino acids 327 to 384 (58 residues), 91.7 bits, see alignment E=2e-30

Best Hits

Swiss-Prot: 92% identical to HISZ_VARPS: ATP phosphoribosyltransferase regulatory subunit (hisZ) from Variovorax paradoxus (strain S110)

KEGG orthology group: K02502, ATP phosphoribosyltransferase regulatory subunit (inferred from 96% identity to vpe:Varpa_3693)

Predicted SEED Role

"ATP phosphoribosyltransferase regulatory subunit (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.17

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>GFF1005 ATP phosphoribosyltransferase regulatory subunit (EC 2.4.2.17) (Variovorax sp. SCN45)
MSAWVLPDHIADVLPSEARHIEELRRQLLDTARGYGYELVMPPLLEHLESLLSGTGEALD
LQTFKLVDQLSGRSMGLRADTTPQVARIDAHLLNRDGVARLCYCGPVLHTRPDRPHATRE
PLQFGAEIYGHAGLEADTETLLLALDCLDAAGLREGVIVDLADARIVRALFAGVPVDAAV
LARVHAALAAKDASELASLTKDFPAASRDGLRALIGLYGDAAVLDEAAKALKDTPGVGAA
LADLKQLAAGLGGVAGRQISFDLADLRGYAYYSGMRFGIYVPGAADSLVRGGRYDEVGAV
FGRNRPAVGFSLDVRELVGVLPARPLRAAIRAPWSDAAGLRQAIAQLRKSGETVVCVLPG
HGSEIDEFHCDRELVEQAGQWSVRTI