Protein Info for GFF1003 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Enoyl-CoA hydratase (EC 4.2.1.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00378: ECH_1" amino acids 9 to 252 (244 residues), 175.1 bits, see alignment E=1.8e-55 PF16113: ECH_2" amino acids 14 to 230 (217 residues), 66.7 bits, see alignment E=2.7e-22

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 60% identity to put:PT7_2672)

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>GFF1003 Enoyl-CoA hydratase (EC 4.2.1.17) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNNELLYEVNDGIAVITINRPERRNALNRAVREGFFEVWRRFEADGQAQVAILTGAGDNF
CAGMDLVEAADTQLRIPPAGFIAVLGDNIEVTKPVIAAVQGYAYAGGWLLSQMCDLCVAD
QTAKFAITEAKVGRGMPWASPVIHMLPQRILMEVAMTGDPLSAQRAYELGYINRLMPKGQ
ALQGAKELATRLMANAPLTVRAAKEMVRLSTEMGRTAALRASNRAFDAVYLSEDALEGPQ
SFREKRKPVWKGH