Protein Info for GFF1003 in Methylophilus sp. DMC18

Annotation: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00055: di-trans,poly-cis-decaprenylcistransferase
  • amino acids 17 to 240 (224 residues), 278.6 bits, E=1.7e-87
• PF01255: Prenyltransf
  • amino acids 24 to 240 (217 residues), 278.7 bits, E=1.7e-87

Best Hits

Swiss-Prot: 60% identical to ISPT_NEIG1: Isoprenyl transferase (uppS) from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 70% identity to mmb:Mmol_1164)

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

• polyisoprenoid biosynthesis (E. coli) (5/5 steps found)
• di-trans,poly-cis-undecaprenyl phosphate biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31

Protein Sequence (252 amino acids)

>GFF1003 Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) (Methylophilus sp. DMC18)
LGFFSSSTKEVPPVQEVPQHVAVIMDGNGRWAKKRFLPRVAGHQRGLESVRAMVKACVRL
QINYLTLFAFSSENWRRPQEEVTFLMSLFLEALDREVKKLHDANVILKLIGDRSAFNAAL
QQKMIEAEAKTAANTGLVLTIAVNYGGRWDVVNAMNQLMQARPDLKQIEECDLLPYLSMP
YAPEPDLFIRTGGETRISNFLLWQLAYTELYFTPTLWPDFDDDAFEAALSSYRQRERRFG
RTSEQLVDGSDA