Protein Info for GFF100 in Sphingobium sp. HT1-2

Annotation: Pyridoxal 5-phosphate (PLP)-dependent ornithine decarboxylase (EC 4.1.1.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02784: Orn_Arg_deC_N
  • amino acids 33 to 262 (230 residues), 126.3 bits, E=1.4e-40
• PF00278: Orn_DAP_Arg_deC
  • amino acids 269 to 347 (79 residues), 28.8 bits, E=1.2e-10

Best Hits

KEGG orthology group: K01581, ornithine decarboxylase [EC: 4.1.1.17] (inferred from 91% identity to sch:Sphch_0782)

Predicted SEED Role

"Ornithine decarboxylase (EC 4.1.1.17) / Arginine decarboxylase (EC 4.1.1.19)" in subsystem Acid resistance mechanisms or Arginine and Ornithine Degradation or Polyamine Metabolism (EC 4.1.1.17, EC 4.1.1.19)

MetaCyc Pathways

• L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (3/3 steps found)
• putrescine biosynthesis II (3/3 steps found)
• arginine dependent acid resistance (1/1 steps found)
• cadaverine biosynthesis (1/1 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (1/2 steps found)
• putrescine biosynthesis I (1/2 steps found)
• putrescine biosynthesis III (1/2 steps found)
• superpathway of polyamine biosynthesis II (5/8 steps found)
• superpathway of putrescine biosynthesis (2/4 steps found)
• aminopropylcadaverine biosynthesis (1/3 steps found)
• superpathway of polyamine biosynthesis I (4/8 steps found)
• spermidine biosynthesis III (1/4 steps found)
• L-lysine degradation X (2/6 steps found)
• bisucaberin biosynthesis (1/5 steps found)
• desferrioxamine B biosynthesis (1/5 steps found)
• desferrioxamine E biosynthesis (1/5 steps found)
• lupanine biosynthesis (1/5 steps found)
• superpathway of ornithine degradation (3/8 steps found)
• L-lysine degradation I (2/7 steps found)
• superpathway of L-arginine and L-ornithine degradation (5/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (3/11 steps found)
• superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (3/16 steps found)
• superpathway of L-lysine degradation (8/43 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutathione metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.17 or 4.1.1.19

Protein Sequence (397 amino acids)

>GFF100 Pyridoxal 5-phosphate (PLP)-dependent ornithine decarboxylase (EC 4.1.1.17) (Sphingobium sp. HT1-2)
LHKHHSALGVATALTPAAPVTLIRPEAAARAARFFTEKFPGRSLYAVKANPSPDLIRTLF
DSGITHFDVASIAEVRLVAETLEGKAKLCFMHPVKAEEAIAEAYHVHGVRTFSLDTIDEL
EKIMRATGDATDLELCARLRVSSEHSELSLASKFGAELGETRELLMATRQAADALGICFH
VGSQAMSPQAYSDAIERVRAAIVDAAVTVDIIDVGGGFPSIYPGMEPVALENYFEAIHRG
FESLPVSYSSELWCEPGRALSAEYSSIIVRVERRRGQELYINDGAYGALFDAAHIGWRFP
VALLREDESEEELEGFSFYGPTCDDMDHMVGPFMVPADVKVGDYIEIGMLGAYGAAMRTG
FNGFTSESTIEVSDEPMASLYAETLPARRRATVIKLG