Protein Info for GEMAOFIL_05587 in Pseudomonas lactucae CFBP13502

Annotation: UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01041: DegT_DnrJ_EryC1
  • amino acids 13 to 373 (361 residues), 365.7 bits, E=1.5e-113

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU5872)

Predicted SEED Role

"UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (EC 2.6.1.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.6.1.-)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Arginine and proline metabolism
• Caprolactam degradation
• Lysine biosynthesis
• Lysine degradation
• Methionine metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.-

Protein Sequence (380 amino acids)

>GEMAOFIL_05587 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (Pseudomonas lactucae CFBP13502)
MSQQPFLPFSKPTIDEATISAVGDVLRSGWITSGPKVQAFEAQLSEYFGGRPVRTFNSGT
CTMEIALRIAGVGPGDEVITTPISWVATANVILEVGATPVFADIDPVTRNIDLAQVEAAI
TPRTKAIIPVYLAGLPLDMPMLYALANKYNLRIVEDAAQALGSSWDGERIGATGDFVSFS
FQANKNITCSEGGCLVLNNAEEARLAEKYRLQGVTRSGFDGLDVDVLGGKFNMTDIAAAI
GLGQFAHIEQITAHRQNLARHYFKCFGSDFEAQYGAQLPPADFENSNWHLFQLVLPERQD
GLPARATFMEQMQAHGVGIGYHYPPIHLLSLYRAQGFKEGMFPVAEKVGRLIVSLPMFTA
MTEADVERSVAAVKAVLRAN