Protein Info for GEMAOFIL_03436 in Pseudomonas lactucae CFBP13502

Annotation: 'Pyridoxine/pyridoxamine 5'-phosphate oxidase' transl_table=11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR00558: pyridoxamine 5'-phosphate oxidase" amino acids 3 to 215 (213 residues), 253.8 bits, see alignment E=6.1e-80 PF12766: Pyridox_oxase_2" amino acids 33 to 115 (83 residues), 28.5 bits, see alignment E=3e-10 PF01243: PNPOx_N" amino acids 45 to 162 (118 residues), 78.9 bits, see alignment E=6.4e-26 PF10590: PNP_phzG_C" amino acids 175 to 215 (41 residues), 66.9 bits, see alignment 1.7e-22

Best Hits

Swiss-Prot: 62% identical to PDXH_PSEA7: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: None (inferred from 68% identity to pba:PSEBR_a3159)

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.5

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>GEMAOFIL_03436 'Pyridoxine/pyridoxamine 5'-phosphate oxidase' transl_table=11 (Pseudomonas lactucae CFBP13502)
MPLSLAQLRRNYTLYGLRDDLTQDDPVVLFGQWLDQARKTEVPPAEANSMALATVDRDGH
AHCRILLLKGFSADGFFFFGHYQSAKGEELASNPHAAMTFFWPGLERQVRIEGPVVRAQA
QLSDDYFDARPAASQLGAWASPQSQPLGHRSELESRLREVTERFAGRQPPRPEHWGGYCL
QPRRIEFWQGRPDRLHDRLDYRLHDGQWQRTRLAP