Protein Info for GEMAOFIL_03090 in Pseudomonas lactucae CFBP13502

Annotation: Sensor histidine kinase RcsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF00989: PAS" amino acids 34 to 156 (123 residues), 27.3 bits, see alignment E=6.1e-10 PF13426: PAS_9" amino acids 44 to 158 (115 residues), 30.4 bits, see alignment E=7.8e-11 PF00512: HisKA" amino acids 187 to 255 (69 residues), 77.7 bits, see alignment E=1.1e-25 PF02518: HATPase_c" amino acids 302 to 436 (135 residues), 83.3 bits, see alignment E=3.3e-27

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfs:PFLU3128)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>GEMAOFIL_03090 Sensor histidine kinase RcsC (Pseudomonas lactucae CFBP13502)
MDTTPPSLPQSRAEKLVEFKRQRTLLKAGALQDAIFNSAYFSSIATDEKGVIQIFNVGAE
RMLGYAAADVVNRITPADISDPAELIIRAAALSLELDTPITPGFEALVFKASRGIEDIYE
LTYIRQDGSRLSAMVSVTALRNRSDMIIGYLLIGTDNTARKQEEAQRKRFERALEEKNLE
LEHASRMKSEFLATMSHELRTPLNAVIGFSEALKDGLVGAMSDTQREYIGDIFTSGQHLL
SLINDILDLSKVEAGMMDLELEPVELAGLLANSLLIVREKAAQQRIQLKLDSQGDLGTLM
LDQRKTKQIVYNLLANAVKFSAHAGFVHLAVCEVDRDQVGLVPGDWPVYGFALQPSVHQR
FLELSVSDTGIGIAADDMGKLFKAFSQIDSSLARKFEGTGLGLAMVKQLTDLHGGSVAVA
SREGLGARFVVWLPLHRAKPTEAVWPQS