Protein Info for GEMAOFIL_02267 in Pseudomonas lactucae CFBP13502

Annotation: Ornithine cyclodeaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF02423: OCD_Mu_crystall" amino acids 12 to 312 (301 residues), 359.8 bits, see alignment E=5.7e-112

Best Hits

Swiss-Prot: 63% identical to OCD_PSEPK: Ornithine cyclodeaminase (ocd) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01750, ornithine cyclodeaminase [EC: 4.3.1.12] (inferred from 84% identity to pba:PSEBR_a2902)

MetaCyc: 58% identical to ornithine cyclodeaminase (Agrobacterium tumefaciens)
Ornithine cyclodeaminase. [EC: 4.3.1.12]

Predicted SEED Role

"Ornithine cyclodeaminase (EC 4.3.1.12)" in subsystem Arginine and Ornithine Degradation (EC 4.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.12

Use Curated BLAST to search for 4.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>GEMAOFIL_02267 Ornithine cyclodeaminase (Pseudomonas lactucae CFBP13502)
MTLFLDVDDAARLFAKVGIRRAIREMATYIEADYLRWAQFDKSPRTANHSPDGVIELMPT
DDGKQYSFKYVNGHPDNGQQNLLTVMAFGLLADVHSGYPTLLSELTLTTAVRTAATSALV
ARALARPGATSMALIGNGAQSEFQALAFHEMLGINEIRIFDIDRDASLKLLRNLAAFPTI
KVIHAASVQEAVKGAHIVTTVTADKAYATILTPEMIEPGMHINAVGGDCPGKTELHADIL
RNARVIVEFEPQTRIEGDIQQLEADSPVVEFFRIVQGDVLGRESDEQVTVFDSVGFALED
FSSLRYLQAMAQEHQVGRHIHLVPTPENIKNLFQMLDQQPTKAAHLRTAS