Protein Info for Echvi_4673 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00089: Trypsin" amino acids 113 to 274 (162 residues), 66.8 bits, see alignment E=6.7e-22 PF13365: Trypsin_2" amino acids 114 to 250 (137 residues), 117.1 bits, see alignment E=2.9e-37 PF13180: PDZ_2" amino acids 294 to 380 (87 residues), 59.2 bits, see alignment E=1e-19 PF00595: PDZ" amino acids 311 to 345 (35 residues), 27.5 bits, see alignment 8.6e-10 PF17820: PDZ_6" amino acids 316 to 368 (53 residues), 28.6 bits, see alignment 2.3e-10

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 53% identity to mtt:Ftrac_3090)

Predicted SEED Role

"HtrA protease/chaperone protein"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G7K7 at UniProt or InterPro

Protein Sequence (486 amino acids)

>Echvi_4673 Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MQKSFTTFMLAFVAGLLGAWTYQQFFLTDLSLAGHPSADTQFTSHQINNFTESNAPTTSG
KANGLPVSFVEASERSTESVVFIKNFSGTDYRRYSIFDYFFGPQGGSPQRVSTGSGVIFS
EDGYIITNNHVVEDAETLEVIHQKKTYKAKLIGTDPNTDIAVLKVDAEGLPAIKKGSSRD
LQIGEWVIAVGNPFNLTSTVTAGIVSAKERQINILGGDFPLESFIQTDAAINPGNSGGAL
VNVNGELVGINTAILSKTGTYTGYGFAVPVDIAAKIANDLINYGEVQKAIPGVSTEEITP
EIAEKMGLESLDGVIVNHIIRNGAAEKAGMEVGDIIIGIDDTEVNGKGSFEEALSYHYPG
DQVTLRYLRENKQKRADITLQNLQGGTGVIEKAFFSSALLGAKLEAVNTVDKDRYEIDYG
VKITALTRGYLSELGLGNGFILTEVNGEPAEDPDEIGTFLEEYSGRLVLEGITPRGRVFR
QSYSVR