Protein Info for Echvi_4656 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF00072: Response_reg" amino acids 6 to 115 (110 residues), 95.8 bits, see alignment E=5.7e-31 PF00158: Sigma54_activat" amino acids 153 to 318 (166 residues), 219.4 bits, see alignment E=7.6e-69 PF14532: Sigma54_activ_2" amino acids 153 to 323 (171 residues), 54.9 bits, see alignment E=3.8e-18 PF07728: AAA_5" amino acids 176 to 295 (120 residues), 32.8 bits, see alignment E=2e-11 PF25601: AAA_lid_14" amino acids 324 to 407 (84 residues), 67.4 bits, see alignment E=2.5e-22 PF02954: HTH_8" amino acids 418 to 457 (40 residues), 48.9 bits, see alignment 1.3e-16

Best Hits

KEGG orthology group: K07713, two-component system, NtrC family, response regulator HydG (inferred from 53% identity to shg:Sph21_3147)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G692 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Echvi_4656 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains (Echinicola vietnamensis KMM 6221, DSM 17526)
MANAKILLIEDDLTYSKIIKNFLEKHDYEVDQTSKINEAFVMLDKKPYDLIITDYRLPDG
TGMEVLENIVHNKKNTRVILITNYSDIRTAVRSMKLGAIEYITKPINPDELLTTVNEALK
SPPTRGVPEDQASAVSKSPKKTSKTTAGDAYVVGKSPESLQLEQYISLVAPTEMSVVVLG
ESGTGKEFISKRIHEKSKRSGGPFVAIDCGALSKELAGSELFGHVKGAFTGALDNKTGNF
EMANGGTIFLDEIGNLSYEVQIKLLRAIQERKIRKIGGTKDIPVDVRIIVATNEDLSNAA
KKGEFREDLYHRLNEFSLKSTPLRDRGEDLFHYAAIFLQDANQALGKDILGFNEEVKEIF
KTYSWPGNLRELKNIIKRAVLLTTDDYIQKESLPVDLLLPENSSTQNSNTNDLKSSFEVQ
EKAMIIKTLNEVKHNKSKAAKILNIDRKTLYNKIEKYGID