Protein Info for Echvi_4642 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Organic radical activating enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF04055: Radical_SAM" amino acids 39 to 114 (76 residues), 43.4 bits, see alignment E=2.1e-15

Best Hits

Swiss-Prot: 56% identical to QUEE_FLAPJ: 7-carboxy-7-deazaguanine synthase (queE) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: None (inferred from 66% identity to lby:Lbys_1123)

Predicted SEED Role

"Queuosine Biosynthesis QueE Radical SAM" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G7H9 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Echvi_4642 Organic radical activating enzymes (Echinicola vietnamensis KMM 6221, DSM 17526)
MEIKQAVGKGIKLPVMEAFYTIQGEGTFTGHPAYFIRLGGCDVGCVWCDVKESWEAGKWP
VQSVEEIVEGALQYPGKLVVITGGEPLMYDLGPLTALLKEKGFTINIETSGAHPFSGQFD
WVCFSPKKFKEPHPSIFEKANELKVIVFHKSDFAFAEKHAAKVQPACRKLLQPEWSKAER
YTGEIIDYIKKHPDWNISLQTHKFMDIP