Protein Info for Echvi_4628 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: adenylosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00184: adenylosuccinate synthase
  • amino acids 3 to 419 (417 residues), 491.5 bits, E=1e-151
• PF00709: Adenylsucc_synt
  • amino acids 3 to 419 (417 residues), 558.3 bits, E=5.1e-172

Best Hits

Swiss-Prot: 65% identical to PURA_CYTH3: Adenylosuccinate synthetase (purA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 69% identity to mtt:Ftrac_1133)

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.4

Sequence Analysis Tools

See L0G5H2 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Echvi_4628 adenylosuccinate synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MDVLLGLQWGDEGKGKVVDFLAPKYNMVARFQGGPNAGHTLEFDGIKHVLHQIPSGIFRE
NLKNIIGNGVVLDPVVLRKEIEGLKKFNIAYQQNLFISKKATIIIPTHKLLDAAYEKSKG
DKKIGSTLKGIGPTYQDKIGRVALRVGDILSPDFREKYDALVEKHKAVLAFYDYDISELG
KLEESFFEAVDFFKSLNLINSEYEVNGALTNGDKVLAEGAQGSLLDIDFGSYPFVTSSST
MTAGACTGLGVAPSCIGEVFGIFKAYCTRVGSGPFPTELFDEDGERMRKEGNEFGSTTGR
PRRCGWIDLPALRYSIMINGVTQLYMMKADVLNIFETIKVCTHYKLDDGTVIDQLPFEIN
DVELEPVYKECKGWNKDLSDVTSYDEFPEELKAYVSFLETSLNVPIKMVSVGPDRKQTIL
K