Protein Info for Echvi_4621 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details PF13858: DUF4199" amino acids 15 to 174 (160 residues), 92 bits, see alignment E=2.9e-30

Best Hits

KEGG orthology group: None (inferred from 40% identity to mtt:Ftrac_1792)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G666 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Echvi_4621 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
METHETPFRAALRTGLVLGLMMMVIVYLIYFIEASLLASNWFGLAVLILYFALLLFFGFK
YRKEVGGYLPFGSAFQFSFFTLIVAGIIGLVGNLLLYMVIDPALPQVLADQQMENTMEII
ESFGAADAMSTEQINEMKQGFLDAYSVGGQLKAFGFALIIYAILALIIGAIIKRKEPTQS
Y