Protein Info for Echvi_4620 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycosyltransferases involved in cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 235 to 256 (22 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 5 to 167 (163 residues), 107 bits, see alignment E=1e-34 PF10111: Glyco_tranf_2_2" amino acids 5 to 109 (105 residues), 45.9 bits, see alignment E=5.5e-16

Best Hits

KEGG orthology group: None (inferred from 69% identity to mtt:Ftrac_3008)

Predicted SEED Role

"Glycosyl transferase, group 2 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5G7 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Echvi_4620 Glycosyltransferases involved in cell wall biogenesis (Echinicola vietnamensis KMM 6221, DSM 17526)
MTQISIIVPVYNEEESLPELTTWIERVMHEHRFSYELMFINDGSSDKSWEVIGCLAQQNG
HVKAVGFSRNYGKSAALDIGFSKASGDVVITMDADLQDSPDEIPALYAMIMEEGYDIVSG
WKKKRHDPFTKTVPSKFFNGVTRLISGIKLHDFNCGLKAYRNKVVKQIHLYGEMHRYIPL
IAKWNGFNKIGEKAVAHRARKYGTTKFGIERFVHGFLDLISVSFVNRYRKKPMHFFGALG
TISFFGGFLITCWLVFEKVWGIHHGLPVREVTEQPLFFLSLVALIVGVQLFLTGFLAEMM
ISTSSRKGDYNIDEELNFGR