Protein Info for Echvi_4617 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Membrane-fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00529: CusB_dom_1" amino acids 44 to 396 (353 residues), 32.7 bits, see alignment E=9e-12 PF16576: HlyD_D23" amino acids 168 to 332 (165 residues), 38.5 bits, see alignment E=1.2e-13 PF13437: HlyD_3" amino acids 219 to 323 (105 residues), 31.7 bits, see alignment E=3.3e-11

Best Hits

KEGG orthology group: None (inferred from 51% identity to mtt:Ftrac_3121)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3H1 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Echvi_4617 Membrane-fusion protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKNLLFVAVGSVVAILVLYFIFSPTASGDGADIIVPVEKGKFTVEIATTGELKALRSVM
IMGPTRAREFRVNQLTIERMVEEGTVVKKGDFIASLDKSELFGKLSDGQNNLDSEVAQYE
QAKLDTALTLRQERDNILNLEYNVEQKKLVLEQSQYEPPATIKQNEYDLEKAERDLDQAR
QNYKIKYNQALAKMAERTARLRKEEREFQAMNDLLDEFTITAPQDGMVIYRTNWDGNKIA
EGSQISAWNPVVATLPDLTEMQSITYVNEVEIRKVKVGQEVKIGLDAFPEKEFTGKVTRV
ANVGQQRPNSDAKVFEVEILVNESDPVMRPAMTTSNTIIAEELEDAIFVPLEAVHVQNDS
INYVYLNNGVKQEIKLGLSNYDEAIVELGLEEGDKVYLSIPNWGESQSVKLLEELNGKRN
LKEEETAQPEAPKRPTPGGGQRGGKPAAGGAKAGKKASNS