Protein Info for Echvi_4608 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 18 to 173 (156 residues), 83.6 bits, see alignment E=6e-28 PF04542: Sigma70_r2" amino acids 21 to 87 (67 residues), 46.9 bits, see alignment E=3.9e-16 PF07638: Sigma70_ECF" amino acids 46 to 166 (121 residues), 34 bits, see alignment E=5.6e-12 PF08281: Sigma70_r4_2" amino acids 121 to 167 (47 residues), 41 bits, see alignment E=2.4e-14 PF04545: Sigma70_r4" amino acids 126 to 172 (47 residues), 44.2 bits, see alignment E=2.2e-15

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 45% identity to mtt:Ftrac_3318)

Predicted SEED Role

"RNA polymerase sigma-70 factor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G7F0 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Echvi_4608 RNA polymerase sigma factor, sigma-70 family (Echinicola vietnamensis KMM 6221, DSM 17526)
MQEDQLITGLRAKDKRTVDYLYEKYSRALFVVISRVIKDHDIAEEVFHDAFVKIIRRIDS
YDESKGRLYTWMANVCRNAAIDKTRSKEFSKDSKTNTIDNYVYGLEGTSGTTEAVDGIGV
KELITNLNEEQRFVVECIYFKGYTHSEISEEFEIPLGTVKSRIRAALGVLKKNINRI