Protein Info for Echvi_4603 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ATPase related to the helicase subunit of the Holliday junction resolvase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 PF05496: RuvB_N" amino acids 10 to 124 (115 residues), 66.5 bits, see alignment E=1.3e-21 PF14532: Sigma54_activ_2" amino acids 35 to 137 (103 residues), 34.2 bits, see alignment E=1.6e-11 PF00004: AAA" amino acids 43 to 146 (104 residues), 71.9 bits, see alignment E=4.1e-23 PF20720: nSTAND3" amino acids 43 to 102 (60 residues), 31.3 bits, see alignment E=8.5e-11 PF07728: AAA_5" amino acids 43 to 130 (88 residues), 28.8 bits, see alignment E=6.2e-10 PF16193: AAA_assoc_2" amino acids 175 to 247 (73 residues), 83.8 bits, see alignment E=4.7e-27 PF12002: MgsA_C" amino acids 248 to 414 (167 residues), 238.3 bits, see alignment E=2.5e-74

Best Hits

KEGG orthology group: K07478, putative ATPase (inferred from 71% identity to cpi:Cpin_0165)

Predicted SEED Role

"ATPase, AAA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G7E5 at UniProt or InterPro

Protein Sequence (420 amino acids)

>Echvi_4603 ATPase related to the helicase subunit of the Holliday junction resolvase (Echinicola vietnamensis KMM 6221, DSM 17526)
MSQEPLAERMRPAKLEELIGQEHLSKEGTFLHRAIRSGTVPSLILWGPPGVGKTTIANII
ANEVKAPFYTLSAISSGVKDIRQVIEKARFQQGVVLFIDEIHRFNKSQQDALLGAVEKGH
IRLIGATTENPSFEVNAALLSRCQVFTLNHLEKESLEAMVHQAMEKDPLIKSKPIELKET
EALLRLSGGDGRKLLNLFEIVVNAIPDDPIVITNDKVTEIAQQKVAMYDKSGEQHYDIIS
AFIKSIRGSDPNAAVYWLARMIEGGEDVKFIARRLVILASEDIGNANPNALLLATQCFDA
VKIIGYPEARIILSQCVTYLASSAKSNASYVAINEAQAIVRQEGDLPVPIHLRNAPTKLM
KDLNYGKGYKYAHDYPGSFVEEEFMPDKLKGKKLYEPGANARENDLRKNLQRLWGKKYGY