Protein Info for Echvi_4585 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Mg-chelatase subunit ChlD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 315 to 342 (28 residues), see Phobius details PF00092: VWA" amino acids 102 to 212 (111 residues), 24 bits, see alignment E=6.2e-09 PF13519: VWA_2" amino acids 102 to 207 (106 residues), 65.1 bits, see alignment E=1.2e-21

Best Hits

Predicted SEED Role

"TPR domain protein in aerotolerance operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5D0 at UniProt or InterPro

Protein Sequence (574 amino acids)

>Echvi_4585 Mg-chelatase subunit ChlD (Echinicola vietnamensis KMM 6221, DSM 17526)
MFEDLFPIDWEAFHFLRPTLLWGFAGVGLLLVLGLANLQERMPWKKHIAPHLRPFMIAKG
SGRMKLIMHLLMVFGLSLGVLALAGPTWKKVEVPGQVLETPMVILLDLSQSMLADDIQPN
RLERAKFKVADLLDARPGARVALVGYAGTAHTIVPLTSDYNIIKSHIETLSPKVMPFRGS
DLSKGLALADSLMAVTAAPGTVLLLSDDFSEETFKTIQGFMTSRKGRLEIMPFNTPSGGE
VPAYAGSGSLTVGGKAVHSAMDATVLSQLGSLENCRVHTLTLDDSDVKWIAEHVRENLRF
TEEPEEKQDQWRDAGLLLVIPAALILLMWFRRGWVVFGLAVMLSSCGQKEPLEGFADLWY
TRDYQGQRKSDVGDFEEAAKLYHDPLRKGVAFYKAGDYDDAIQALSQDTTAMGSYNLGLA
YFKVGDYAAAQMAFGMAAVQDPTLAVATKNKQALDRVLSGGREMDPASAEEQAEKGPAKT
RQNKSPEDLSGGGQEATKKDMEKERLSETATTGTRTAKEMDEVPDDFKSGGGADDAQKVL
LRKIDDDPARFLQKKFEFEVKRKKIKPDPNEKAW