Protein Info for Echvi_4537 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 925 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 28 to 102 (75 residues), 64.9 bits, see alignment E=2.1e-21 PF13715: CarbopepD_reg_2" amino acids 29 to 114 (86 residues), 66.7 bits, see alignment E=4.5e-22 PF08308: PEGA" amino acids 42 to 105 (64 residues), 22.5 bits, see alignment 2.7e-08 TIGR01782: TonB-dependent receptor" amino acids 121 to 921 (801 residues), 506.1 bits, see alignment E=1.1e-155 PF07715: Plug" amino acids 129 to 233 (105 residues), 63.7 bits, see alignment E=6.4e-21 PF00593: TonB_dep_Rec" amino acids 450 to 890 (441 residues), 135.2 bits, see alignment E=1.9e-42 PF14905: OMP_b-brl_3" amino acids 599 to 918 (320 residues), 115.5 bits, see alignment E=1e-36

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G779 at UniProt or InterPro

Protein Sequence (925 amino acids)

>Echvi_4537 TonB-dependent receptor (Echinicola vietnamensis KMM 6221, DSM 17526)
MKNLLLKTLTLMAFCCLGQEALFAQGVLRGRVIDAQNLSMPGANVVLQNTRLGTVTNQAG
DYAIVDLPEGEYEVSVSYLGYGSVVHTATVEDGETTILNFKLDQKTIENLEFVVMGDRLK
GQAKALSQQKNNPNITNIVSSDQIGRFPDANIGDALKRIPGITMQNDQGEARDIIIRGMA
PQLNSVTLNGERIPSAEGDNRRVQMDLIPSDMIQTIEVNKAVLPNMDADAIGGSVNLVTR
QAPNNLRISGTAASGINLLSDKPIWTGAMIVGNRFLNDKLGAIVSASYNNHNFGSENIES
VWYESDNGVGLEEFEMRKYLVQRVRRSVSLALDYEINPNHTLLFSSMYNHRDDWENRFAM
KVDNLDDVFDDGNYEERSPGVFTSSGARVEYETKGGQVAGRNKQPRRLEDQRVKNFTLGG
DHLFNKLKMDWSATYAKASEERPHERYITFREEDQNVNIDITNPRKPYAALTNLSDNLGF
GLDNLSDEYQYTFDEDLNAKLDFKLPYSDKGIVQFGGRYRGKYKNRNNNYFEYSPLDEDA
FGTTLGDMPYTDQSDPDFLPGSQYLIGNFADPDFLGNLELNDPSLFERESVLEEFLPGNY
SANETITAAYAMADHQFTEKLSAIVGLRWEHTSIDYTGNLYDVDNETFTQATQDDSYSNF
MPGVHLKYDADPNTILRFAWTNTIARPNYYDLVPYAEYVAEDDELSRGNPDLLPTVSMNF
DLMAEKYFDNVGLISLGGFYKDIDQFVYEKTDLNYNDPVFGDNLEYTRPENGGTAAVYGL
EASIQKQIWKGLGIYLNYTLTQSETTGIEGREEDDLELPGTAQHMFNASLSYETKKLVFR
ASLNYAGDYLDELGGSQFEDRYYDEQMFLDINASYAFTPKWRLFVEGNNLTNQPLRYYQG
IRARTMQEEYYNARFNFGIKFDLFE