Protein Info for Echvi_4510 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Cystathionine beta-lyases/cystathionine gamma-synthases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 84 to 102 (19 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details PF01053: Cys_Met_Meta_PP" amino acids 12 to 401 (390 residues), 404.8 bits, see alignment E=8.6e-125 PF01212: Beta_elim_lyase" amino acids 64 to 195 (132 residues), 30.4 bits, see alignment E=7.6e-11 PF01041: DegT_DnrJ_EryC1" amino acids 66 to 197 (132 residues), 20.2 bits, see alignment E=9.1e-08 PF00155: Aminotran_1_2" amino acids 69 to 223 (155 residues), 32.3 bits, see alignment E=2e-11 PF06838: Met_gamma_lyase" amino acids 71 to 230 (160 residues), 27.8 bits, see alignment E=2.9e-10 PF00266: Aminotran_5" amino acids 80 to 218 (139 residues), 28.4 bits, see alignment E=2.6e-10

Best Hits

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 61% identity to mbn:Mboo_1995)

Predicted SEED Role

"Cystathionine gamma-lyase (EC 4.4.1.1)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.1

Use Curated BLAST to search for 4.4.1.1 or 4.4.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G384 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Echvi_4510 Cystathionine beta-lyases/cystathionine gamma-synthases (Echinicola vietnamensis KMM 6221, DSM 17526)
MEKPDFKNLGEQTRAIHAGELPDPVTGASSPNLVMSTTYLAEAGTGFSVEGHDEEDPWIY
TRWGNPTVHQLEEKLAVLEEAETAVAFASGMGAITVLFFHLLKAGDHAIVSDVAYAALSE
MTNEMVPSLNIQITKVDTSDLSAVKAAVKNNTRLIYIETPCNPILRLTDIEAVAGIARGA
GARLAVDSTFATPAATKPLQLGADFIVHSLTKYLGGHGDALGGAILGRKADLAPLRKKTA
IRMGAVISPFNAWLILRGLATFPIRMRAHEKNALKVAAFLEKHPKVKRVIYPGLPSHPQH
ELAKKQMKNFSGMLTFQVENGKKRSGIFADKLRIVHYAVSLGHHRSLIFYLDSADLKESS
FKFATGKQDESWEIYAGDGIFRLSVGLEDSKDIIDDLNRALDG