Protein Info for Echvi_4510 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Cystathionine beta-lyases/cystathionine gamma-synthases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01053: Cys_Met_Meta_PP
  • amino acids 12 to 401 (390 residues), 404.8 bits, E=8.6e-125
• PF01212: Beta_elim_lyase
  • amino acids 64 to 195 (132 residues), 30.4 bits, E=7.6e-11
• PF01041: DegT_DnrJ_EryC1
  • amino acids 66 to 197 (132 residues), 20.2 bits, E=9.1e-08
• PF00155: Aminotran_1_2
  • amino acids 69 to 223 (155 residues), 32.3 bits, E=2e-11
• PF06838: Met_gamma_lyase
  • amino acids 71 to 230 (160 residues), 27.8 bits, E=2.9e-10
• PF00266: Aminotran_5
  • amino acids 80 to 218 (139 residues), 28.4 bits, E=2.6e-10

Best Hits

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 61% identity to mbn:Mboo_1995)

Predicted SEED Role

"Cystathionine gamma-lyase (EC 4.4.1.1)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.1)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• D-serine degradation (3/3 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-methionine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
• L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• homocysteine and cysteine interconversion (3/4 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• seleno-amino acid detoxification and volatilization III (2/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
• hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
• dimethyl sulfide biosynthesis from methionine (1/2 steps found)
• seleno-amino acid detoxification and volatilization I (1/2 steps found)
• glycine betaine degradation III (4/7 steps found)
• L-threonine degradation I (3/6 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• superpathway of L-threonine metabolism (11/18 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)
• hypoglycin biosynthesis (4/14 steps found)
• purine nucleobases degradation II (anaerobic) (9/24 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism
• Methionine metabolism
• Nitrogen metabolism
• Selenoamino acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.1

Use Curated BLAST to search for 4.4.1.1 or 4.4.1.11

Sequence Analysis Tools

See L0G384 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Echvi_4510 Cystathionine beta-lyases/cystathionine gamma-synthases (Echinicola vietnamensis KMM 6221, DSM 17526)
MEKPDFKNLGEQTRAIHAGELPDPVTGASSPNLVMSTTYLAEAGTGFSVEGHDEEDPWIY
TRWGNPTVHQLEEKLAVLEEAETAVAFASGMGAITVLFFHLLKAGDHAIVSDVAYAALSE
MTNEMVPSLNIQITKVDTSDLSAVKAAVKNNTRLIYIETPCNPILRLTDIEAVAGIARGA
GARLAVDSTFATPAATKPLQLGADFIVHSLTKYLGGHGDALGGAILGRKADLAPLRKKTA
IRMGAVISPFNAWLILRGLATFPIRMRAHEKNALKVAAFLEKHPKVKRVIYPGLPSHPQH
ELAKKQMKNFSGMLTFQVENGKKRSGIFADKLRIVHYAVSLGHHRSLIFYLDSADLKESS
FKFATGKQDESWEIYAGDGIFRLSVGLEDSKDIIDDLNRALDG