Protein Info for Echvi_4508 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF06342: DUF1057" amino acids 54 to 184 (131 residues), 30.5 bits, see alignment E=5e-11 PF12146: Hydrolase_4" amino acids 73 to 275 (203 residues), 76.5 bits, see alignment E=5.2e-25 PF00561: Abhydrolase_1" amino acids 74 to 324 (251 residues), 100.9 bits, see alignment E=2.3e-32 PF12697: Abhydrolase_6" amino acids 75 to 324 (250 residues), 70.4 bits, see alignment E=9e-23 PF03096: Ndr" amino acids 110 to 175 (66 residues), 27.9 bits, see alignment E=2.5e-10

Best Hits

KEGG orthology group: None (inferred from 61% identity to psn:Pedsa_1806)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G561 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Echvi_4508 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKYSLIIPLLLVINVVFSQTERPVLDIMLTNYNYPYEVHFLNFKLQNQELKMAYMDVHP
KKPNALPAGRQVKTVVLLHGKNFNGAYWKTTIEALTDEGYRVIVPDQVGFGKSSKPVGYQ
FTFQQLAQNTKAVLDELKIDKIYLLGHSMGGMLATRFTLMYPEVVEKLVLENPIGLEDWK
LVAPYVSIDANYQKELKANYESARQYQSASYYDNHWKHEYDEWVYLLTGWVKSPDYPIVA
KINAQTSDMIFTQPVVYEFQNINAPTLLIIGTRDRTAIGRNNVKDPEVAAKMGQYQLLGK
ATQQKIPNAELVELDNVGHLPHIEVFDRFIKPLKEFLNP