Protein Info for Echvi_4473 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Fe2+/Zn2+ uptake regulation proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF01475: FUR" amino acids 15 to 113 (99 residues), 40.1 bits, see alignment E=1.9e-14

Best Hits

KEGG orthology group: K03711, Fur family transcriptional regulator, ferric uptake regulator (inferred from 70% identity to mtt:Ftrac_1212)

Predicted SEED Role

"Zinc uptake regulation protein ZUR" in subsystem Oxidative stress or Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5T0 at UniProt or InterPro

Protein Sequence (140 amino acids)

>Echvi_4473 Fe2+/Zn2+ uptake regulation proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MSTIKELEENLLQHKIKPTAMRLLVLEYLLDHEIAVSLTDLYRDFVKSDRTTIYRTLKAF
EDNGLVHSIDDGTGVPKYALCETGCKCEIERDLHLHFHCRKCGETKCLYSYKIPEIVLPP
NHQAEEANLVVKGVCSQCSG